Sequence 1: | NP_570017.1 | Gene: | Spg7 / 31253 | FlyBaseID: | FBgn0024992 | Length: | 819 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001292581.1 | Gene: | Bcs1l / 66821 | MGIID: | 1914071 | Length: | 418 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 58/206 - (28%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 351 QEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLAKAVATEAQ--VPFLSMNGSEFIEM 413
Fly 414 IGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIGRQRSGTESMGQGSSGESEQTLNQLLVEMDGMA 478
Fly 479 TKEGVLMLASTNRADILDKALLRPGR------------------FDRHILIDLPTLAERKEIFEK 525
Fly 526 HLSSVKLESPP 536 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spg7 | NP_570017.1 | FtsH_ext | 171..276 | CDD:284011 | |
FtsH_fam | 333..787 | CDD:273520 | 58/206 (28%) | ||
AAA | 378..513 | CDD:278434 | 42/154 (27%) | ||
Peptidase_M41 | 595..785 | CDD:279742 | |||
Bcs1l | NP_001292581.1 | BCS1_N | 24..191 | CDD:214980 | |
AAA | 223..354 | CDD:214640 | 42/139 (30%) | ||
AAA | 226..355 | CDD:278434 | 40/137 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0465 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |