DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spg7 and BCS1L

DIOPT Version :10

Sequence 1:NP_570017.1 Gene:Spg7 / 31253 FlyBaseID:FBgn0024992 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_004319.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens


Alignment Length:207 Identity:57/207 - (27%)
Similarity:98/207 - (47%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 QEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLAKAVATEAQ--VPFLSMNGSEFIEM 413
            ::|:||:|   :|:.|...|....||.||.|||||||:....|:|.|.:  :..||:..|     
Human   203 RDVQEFID---NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDS----- 259

  Fly   414 IGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIGRQRSGTESMGQGSSGESEQTLNQLLVEMDGMA 478
              .|...|:..|.....:::  ::.::::||....|...........|....|.:.||..:||:|
Human   260 --SLSDDRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVA 320

  Fly   479 TKEGVLMLASTNRADILDKALLRPGRFDRHILIDLPTLAERKEIFEKHLSSVKLESPPTTFSQRL 543
            :.|..::..:||..|.||.||:||||.|....:...:..:..::|::.... :..|....|::.:
Human   321 STEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPG-QAPSLAENFAEHV 384

  Fly   544 ARLTPGFSGADI 555
            .|.|...|.|.:
Human   385 LRATNQISPAQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spg7NP_570017.1 HflB 178..788 CDD:440233 57/207 (28%)
BCS1LNP_004319.1 BCS1_N 24..191 CDD:214980
RecA-like_BCS1 201..353 CDD:410918 50/161 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.