DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spg7 and bcs1l

DIOPT Version :9

Sequence 1:NP_570017.1 Gene:Spg7 / 31253 FlyBaseID:FBgn0024992 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_957476.2 Gene:bcs1l / 394157 ZFINID:ZDB-GENE-040426-938 Length:420 Species:Danio rerio


Alignment Length:311 Identity:79/311 - (25%)
Similarity:130/311 - (41%) Gaps:85/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 RMKSIKSPLSMD----------SFNQMGRAKFTLVDPF----------DGGRGVLFRDV------ 343
            |::.::....||          :|..:||.:.|..:..          :.||.|::..:      
Zfish   114 RVERVREKQMMDLHTGTPWESVTFTALGRDRQTFFNILQEARELALKQEEGRTVMYTAMGAEWRP 178

  Fly   344 ----------------AGLSE-AKQEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLA 391
                            :|::| ...:||||:.   :|:.|...|....||.||.|||||||:...
Zfish   179 FGFPRRRRPLSSVVLESGVAERIVDDVKEFIG---NPKWYTDRGIPYRRGYLLYGPPGCGKSSFI 240

  Fly   392 KAVATEAQVPFLSMNGSEFIEMIGGLGAARVRDLFKEGKKRAPCIIYIDEIDA--IGRQRSGTES 454
            .|:|.|.......|:.|:     ..|...|:..|.....:::  ||.::::||  :.|:...||:
Zfish   241 TALAGELGYSICLMSLSD-----RSLSDDRLNHLLSVAPQQS--IILLEDVDAAFVSRELLPTEN 298

  Fly   455 ----MGQGSSGESEQTLNQLLVEMDGMATKEGVLMLASTNRADILDKALLRPGRFDRHILIDLPT 515
                .|.|     ..|.:.||..:||:|:.|..::..:||..:.||.||:||||      :||  
Zfish   299 PLAYQGMG-----RLTFSGLLNALDGVASSEARIVFMTTNFIERLDPALVRPGR------VDL-- 350

  Fly   516 LAERKEIFEKHLSSVKLESPPTTFSQRLARLTPGFSGADIANVCNEAALHA 566
                 :.:..|.|..:|       :|...|..|..|.|: |:..:|.||.|
Zfish   351 -----KQYVGHCSHWQL-------TQMFRRFYPQESAAE-ADHFSEQALAA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spg7NP_570017.1 FtsH_ext 171..276 CDD:284011
FtsH_fam 333..787 CDD:273520 72/263 (27%)
AAA 378..513 CDD:278434 43/140 (31%)
Peptidase_M41 595..785 CDD:279742
bcs1lNP_957476.2 BCS1_N 24..176 CDD:214980 10/61 (16%)
AAA 223..355 CDD:214640 47/156 (30%)
AAA 226..355 CDD:278434 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.