DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spg7 and CG4908

DIOPT Version :9

Sequence 1:NP_570017.1 Gene:Spg7 / 31253 FlyBaseID:FBgn0024992 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster


Alignment Length:326 Identity:89/326 - (27%)
Similarity:140/326 - (42%) Gaps:36/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 EKLRDVEKRLGIKDGVP---VTYDRQTDTTGRILMLLLVCALLMSIATRMKSIKSPLSMDSFNQM 321
            |:.|: ::.|.:..|||   ||.....:..|....:|.....|...||..|::       .:..|
  Fly   117 ERTRE-QQTLDLHMGVPWETVTLTAFGNNKGIYFDILEEARQLALEATEGKTV-------LYTAM 173

  Fly   322 GRAKFTLVDPFDGGR-----GVLFRDVAGLSEAKQEVKEFVDYLKSPEKYQRLGAKVPRGALLLG 381
            | |::.   ||...|     |.:..| .|.|:  :.:.:..|::||...|.:.|....||.||.|
  Fly   174 G-AEWR---PFGHPRRRRPTGSVVLD-RGTSQ--RIIADCQDFIKSSLWYTQRGIPYRRGYLLYG 231

  Fly   382 PPGCGKTLLAKAVATEAQVPFLSMNGSEFIEMIGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIG 446
            ||||||:....|:|.|.:.....:|.||     .||...|:..|.....:::  ||.:::|||..
  Fly   232 PPGCGKSSFITALAGELEYSVCLLNLSE-----RGLTDDRLNHLLNVAPEQS--IILLEDIDAAF 289

  Fly   447 RQRSGTESMGQGSSGESEQTLNQLLVEMDGMATKEGVLMLASTNRADILDKALLRPGRFDRHILI 511
            ..|..|........|.:..|.:.||..:||:.:.|..::..:||..|.||.||:||||.|....|
  Fly   290 VSREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYI 354

  Fly   512 DLPTLAERKEIFEKHLSSVKLESPPTTFSQRLARLTPGFS-GADIANVCNEAALHAARNTQMEVS 575
            ...|..:.:|:|:...:     |..||.::...:....|. .|..|.:......|...:.|..:.
  Fly   355 GYCTQYQLEEMFKNFFA-----SSDTTKAEEFGKRVNSFGRSASPAQIQGFFMKHKLSSPQTVID 414

  Fly   576 S 576
            |
  Fly   415 S 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spg7NP_570017.1 FtsH_ext 171..276 CDD:284011 4/15 (27%)
FtsH_fam 333..787 CDD:273520 70/250 (28%)
AAA 378..513 CDD:278434 46/134 (34%)
Peptidase_M41 595..785 CDD:279742
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 21/86 (24%)
RecA-like_BCS1 202..354 CDD:410918 52/158 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.