DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG34316

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster


Alignment Length:234 Identity:45/234 - (19%)
Similarity:90/234 - (38%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNLAN--- 102
            |:.:||..|.|.....:.||...:.||:|:.||....|. .:...:.|..::.:.:|:.|::   
  Fly    29 EAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETEL-NNKYLVDFTGSIDNFQLHGLSDFDV 92

  Fly   103 -SMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKL-LILPIVSKGD-----------L 154
             ::.:..:.|        ||.|:.:..|....::.|...|.| .||.:...|:           :
  Fly    93 PALSLSPVPG--------LKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILI 149

  Fly   155 TIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQ 219
            :.||..|                 :.|.|:..:...::.|...:..||..::: :.|....::|:
  Fly   150 SFRLRSV-----------------SPLAISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNE 196

  Fly   220 ------------EWSTLALDVQPKINEACAK-AFSAIVQ 245
                        |..|:...||..:|....: :.|.|:|
  Fly   197 MGVELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLSDIIQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 45/234 (19%)
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 41/225 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.