DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG17189

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:113/270 - (41%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVWVGLLSWVSCRVDASE--GF----PSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIP--ERQ 63
            ::.:|||..:...:..::  .|    ||.::.||:.:   ..|.....|.|......|:|  |..
  Fly     1 MLLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65

  Fly    64 VAALEPIALGTMFIESGGHSESIKFKLTMSD-----AKLYNLA----NSMMVKSLKGFTKDLTRP 119
            ...::|:           ..|.:.||...||     |.|.::.    ..|::|..|...||.:..
  Fly    66 FGPIDPM-----------RQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWL 119

  Fly   120 LKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNIT 184
            .|:.|    |::.:...|.:.|::|::|:...|.:.:.::|:.. :..|...:....|:|:.|:|
  Fly   120 TKIYL----PQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDI-LMTTKTRLYEKGGYTFYNVT 179

  Fly   185 DYKTATKIKGGHFDLSNLFN-DNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLW 248
            ..|....:......|.|||| .:||:.|||.:..|..|..:...::|.:.|...:....::...:
  Fly   180 SVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244

  Fly   249 ANIPYDEFFE 258
            |..|...|.|
  Fly   245 ALFPASFFVE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 56/247 (23%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 55/245 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.