DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG11854

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:129/258 - (50%) Gaps:11/258 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLTGASMFLVWVGLLSWVSCRVDASEGFPSPLKRCKLQDESCLLAQAQTFFQAF-KNGIPERQV 64
            |:||     |..|.|....|....||: |||.::||.:.||.||..:.....:.: |:||.|..:
  Fly     1 MELT-----LALVLLFGCASTYGHASD-FPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGL 59

  Fly    65 AALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNP 129
            ..|:|:.:....|....|| .:...|:..:..:..| :..:.|.:.|||:||:|.::  |:::.|
  Fly    60 IPLDPLHVKKFKIGRNPHS-PVNIDLSFHEMDILGL-HQGVAKRVSGFTRDLSRSIE--LVMEVP 120

  Fly   130 ELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKG 194
            |:.||..|.|||::|||||...|...|||.....:..|..:.|.:.|..||..:.:.|.......
  Fly   121 EIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSH 185

  Fly   195 GHFDLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257
            ..:.|.||||..|:|.::...::|:.|..:..:::|.|.||......::|..::..:|.::.|
  Fly   186 VTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 67/230 (29%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.