DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and to

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:127/254 - (50%) Gaps:7/254 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MFLVWVGLLSWVSCRVDASEGFPSPLKRCKLQDESCLLAQAQTFF-QAFKNGIPERQVAALEPIA 71
            ||.:...::..:...|||.  ||...|.||..|..|::....|.| :....|.|...:..|:|:.
  Fly     1 MFAIAFAVVLCLLVSVDAK--FPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLK 63

  Fly    72 LGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAK 136
            :..|.|..|..|..:...||.:|..||.:.:..:|| :|||.:|||...::.::  .....:...
  Fly    64 VDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVK-VKGFGRDLTAKHEVKIV--TKTFSLVGP 125

  Fly   137 YDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSN 201
            |::.||:|||||...|...:.:.:|...|..:.:|:.: :|.|||::||.|...|.:..|:..||
  Fly   126 YNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVK-NGETYLDVTDLKITMKPESSHYHFSN 189

  Fly   202 LFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFFEKE 260
            |||.:|.|.|:....||:....:..:....|:.:..|.:..:|:.:::.:||.:||..|
  Fly   190 LFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 67/229 (29%)
toNP_001287525.1 JHBP 5..245 CDD:284096 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.