DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG11852

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:252 Identity:67/252 - (26%)
Similarity:122/252 - (48%) Gaps:7/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MFLVWVGLLSWVSCRVDASEGFPSPLKRCKLQDESCLLAQAQTFF-QAFKNGIPERQVAALEPIA 71
            |.|:.:|.::...|.|..:..||..|.||.:.|.||::..:.... |..:.|.|......:||..
  Fly     1 MMLLQLGCVALFCCLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQVEPFL 65

  Fly    72 LGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAK 136
            : ..|..|.|.:.|:..||...|..:..|::....::: ||..| ....|..:....|::.::.|
  Fly    66 I-KRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAV-GFGAD-PATSKFEMYGSFPKIVLKGK 127

  Fly   137 YDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEP-VKRSDGHTYLNITDYKTATKIKGGHFDLS 200
            |..||::|||||...||..|.|:  :.|..:..:| .::.:|.|||::...|...:.:..:..|.
  Fly   128 YVADGRILILPIRGDGDAEIVLH--NPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLE 190

  Fly   201 NLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257
            ||||.::.|..:..:.||..|:.:..::.|.|:.|.|:...:::..|:....|::.|
  Fly   191 NLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 62/231 (27%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.