DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG10264

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:227 Identity:65/227 - (28%)
Similarity:107/227 - (47%) Gaps:17/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSPLKRCKL---QDESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLT 91
            ||.|:.||.   .::.|.....:..|.|...||||..|.:.||:.:..:.:..|  |.::.....
  Fly    45 PSWLQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKG--SGNLVLSGG 107

  Fly    92 MSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTI 156
            ..|..:...:|:    :::..:.||.|.| |...|:.|.|.:||||::.|.:|:||:|..||:.:
  Fly   108 FQDLVIRGPSNA----TVRRASLDLERRL-LNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAM 167

  Fly   157 RLNDVHTKVW--ITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQ 219
            .|.:|||.|:  |:.....|: |...::|.:.|....:......|.||||.|:.|..|....|||
  Fly   168 ALKNVHTTVYTRISLRNETRT-GDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQ 231

  Fly   220 EWSTLALDVQPKINEACAKAFSAIVQSLWANI 251
            ....:..:::|.:....|..|    ..||.|:
  Fly   232 NGKEVIAELRPDLELGLADIF----HGLWNNV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 65/227 (29%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126443at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.