DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG2016

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:262 Identity:55/262 - (20%)
Similarity:108/262 - (41%) Gaps:20/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTGASMFLVWVGLLSWVSCRVDASEGFPSPLKRC---KLQDESCLLAQAQTFFQAFKNGIPERQV 64
            ::|..:|:|.|.:|.....:..     |..|::|   :.|...||...........:.|:||..:
  Fly     1 MSGKMVFIVLVAVLGSTFAQEQ-----PYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDI 60

  Fly    65 AALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNP 129
            ..:||:.:..:.|..|...:.  ::....:.:.|.::| :.|.:::   .||. .|:..|..:.|
  Fly    61 YEIEPVMIDEIGIVLGSGPDG--YRALFRNIQAYGVSN-ITVTNIR---SDLD-SLQFQLTCEIP 118

  Fly   130 ELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKG 194
            .:.|:|:|...|.|:::.....||.......|..|::..|...:..||.|||.....|....:|.
  Fly   119 RIRVKAQYRSTGVLILVKASGAGDYWGEYEGVKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKE 183

  Fly   195 GHFDLSNLFNDNKELRDSTLKV-----LNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYD 254
            ....:.|:.|.|..:..|:.:.     :|.....|..:::|.:...........:..::|.||.|
  Fly   184 IQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLD 248

  Fly   255 EF 256
            |:
  Fly   249 EW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 50/236 (21%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.