DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG14661

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:261 Identity:65/261 - (24%)
Similarity:106/261 - (40%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QLTGASMFLVWVGLLSWVSCRVDASEGFPSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIPERQ 63
            ||..||:.:.:|..:|        :...|..::.|...|   ..||.:...........||.|..
  Fly     4 QLIVASLLICFVACIS--------AGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELN 60

  Fly    64 VAALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNL--ANSMMVKSLKGFTKDLTRPLKLTLLL 126
            |..|||:.:|.:.|..|....::|       ||..|:  |::..:..|:..|::  |.....|:|
  Fly    61 VPPLEPLYIGDLSILDGSAGLTVK-------AKKLNILGASNFEITKLRASTQN--RRFDFELIL 116

  Fly   127 DNPELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATK 191
              |.|.....|:::|.:|.|||...|..|....:....|.:..: :|..:...||::.::....:
  Fly   117 --PHLHGDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYD-IKSVNDLEYLHVKEFVLKIR 178

  Fly   192 IKGGHFDLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEF 256
            ...|:..|.||||.:|.|.|.....:||.:.....|:...|..|....|..|...:..|..|.|.
  Fly   179 TGKGNLKLENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSEL 243

  Fly   257 F 257
            |
  Fly   244 F 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 59/234 (25%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470432
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.