DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG16820

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:245 Identity:48/245 - (19%)
Similarity:94/245 - (38%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CKLQD---ESCLLAQAQTFFQAFK-NGIPERQVAALEPIALGTMFIESG---GHSESIKFKLTMS 93
            |.|..   ..|:....|:|....: .|:||..:.:::|     .|.:.|   ..::.|:..|.:.
  Fly    88 CSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDP-----YFYKRGIFRYTNDGIQGGLLIK 147

  Fly    94 DAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTIRL 158
            :.::|.: :.:.|.|:.....|....:||.:.|  |:|:....:..|.|...|.:|.||...|.:
  Fly   148 NMEIYGI-SQLQVNSVAANFTDNGFIIKLGVEL--PQLKAGGHFKADVKFGGLRLVPKGPFNITI 209

  Fly   159 NDVHTKVWITAEPVKRSDGH-----------------TYLNITDYKTATKIKGGHFDLSNLFNDN 206
            :::...:        .:|||                 ..:||.|.|...         :.:|:| 
  Fly   210 DNIKATI--------LTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVA---------NGIFSD- 256

  Fly   207 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEF 256
            :.|....|.::|:....:.....|...|..|....|.:...:|.:|.::|
  Fly   257 RNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 48/245 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.