DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyw and CG31207

DIOPT Version :9

Sequence 1:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:255 Identity:52/255 - (20%)
Similarity:98/255 - (38%) Gaps:57/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSPLKRCKLQDESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLTMSD 94
            |..:|:|:..|..|::.......:.:..|||   ...|:||.:                 :.:.|
  Fly    23 PKEIKKCRFGDSKCIVNSMNAIIKNYPKGIP---AIGLKPIDV-----------------VDIRD 67

  Fly    95 AKLYNLA--------------------NSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDV 139
            :|.:|.|                    |:.:.| :.||.::.|..| :.:....|.|..:..|..
  Fly    68 SKFWNDAMVGAFWLNFDLFNQVNYGFENTTITK-VSGFDENPTSSL-IEIHGRIPSLIHKGDYFS 130

  Fly   140 DGKLLILPIVSKGDLTIRLND-------VHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHF 197
            .|::.|:.:.|.|:   .|:|       :..||.:.....||     ||.|.:......:....|
  Fly   131 MGRVWIVQMNSTGE---SLSDFQNFRFVLKLKVIMEYRNNKR-----YLKIYELTPFVTMDRWVF 187

  Fly   198 DLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257
            .|.|.|..|.::..:..:|.|..|.....:::|...:..|..|.::.:.::..:|||:.|
  Fly   188 WLDNFFESNTDMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dywNP_570016.1 JHBP 29..258 CDD:214779 52/255 (20%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 52/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.