DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and GAS41

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_199373.1 Gene:GAS41 / 834599 AraportID:AT5G45600 Length:268 Species:Arabidopsis thaliana


Alignment Length:165 Identity:37/165 - (22%)
Similarity:67/165 - (40%) Gaps:31/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQY----MD 120
            |.||:| |....|:|..|::|.|::.........|.:..|||:.|....:|.:.:.:.:    .|
plant    69 WAVYVR-GATNEDISVVVKKVVFQLHSSFNSPTRVIEEPPFEVSESGWGEFEIAMTLHFHSDVCD 132

  Fly   121 ARMSATSYIFRPRVVREGHAG-------ICEEMLDKMIFVNPSP--MMRQNLTPVL----VPSAN 172
            ..:|...::   ::..|..:|       :..|..|:::|.:||.  :.|....|.|    :||..
plant   133 KPLSLYHHL---KLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALTFPRLPSGY 194

  Fly   173 GAPGDRTSPQFAMESAMPETPGERKEQDRDREQVG 207
            ..|    :|.      ..|..|::|..|.....:|
plant   195 NLP----APM------QVEDTGKKKRGDTKDHSLG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 16/63 (25%)
GAS41NP_199373.1 YEATS_TFIID14_like 44..175 CDD:341129 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.