DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Mllt3

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_081602.3 Gene:Mllt3 / 70122 MGIID:1917372 Length:569 Species:Mus musculus


Alignment Length:218 Identity:41/218 - (18%)
Similarity:71/218 - (32%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CVISRDIVIGCRMEQCDPDMPYMLEPT-------WGVYLRPGRDGGDLSRFVRRVTFKMSPRLPL 90
            |.:...:.:|.|.:       ...:||       |.|::| |.:..::..||.:|.|.:....|.
Mouse     5 CAVQVKLELGHRAQ-------VRKKPTVEGFTHDWMVFVR-GPEHSNIQHFVEKVVFHLHESFPR 61

  Fly    91 RLHVADSAPFEIGE--VLGSDFPVEVQVQYMDARMSATSYIFRPRVVR---------EGHAGICE 144
            ...|....|:::.|  ..|...|:||..:..:          .|:.||         |||..:..
Mouse    62 PKRVCKDPPYKVEESGYAGFILPIEVYFKNKE----------EPKKVRFDYDLFLHLEGHPPVNH 116

  Fly   145 EMLDKMIFVNPSPMMRQNLTPVLVPSANGAPGDRTSPQFAMESAMPETPGERKEQDRDREQVGDV 209
            ...:|:.|.||:...|:.|.     .|.|.|........:..|:...:.................
Mouse   117 LRCEKLTFNNPTEDFRRKLL-----KAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

  Fly   210 ARPSQPPAKQPKKRLSVGIPHPI 232
            :..|...:.......|...||.:
Mouse   177 SSSSSSSSSSSSSSTSFSKPHKL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 21/95 (22%)
Mllt3NP_081602.3 YEATS 29..109 CDD:281374 19/90 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..476 8/63 (13%)
Nuclear localization signal. /evidence=ECO:0000255 296..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.