DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and mllt1b

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_005171269.1 Gene:mllt1b / 678639 ZFINID:ZDB-GENE-060421-7142 Length:573 Species:Danio rerio


Alignment Length:151 Identity:35/151 - (23%)
Similarity:61/151 - (40%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMS 124
            |.|::| |.:..|:..||.||.|::....|....|....|:::.|...:.|.:.::|.:.:..  
Zfish    32 WMVFVR-GPEACDIQHFVERVVFRLHDSFPKPKRVCKEPPYKVEESGYAGFLMPIEVYFKNKE-- 93

  Fly   125 ATSYIFRPRVV---------REGHAGICEEMLDKMIFVNPSPMMRQNLT----------PVLVP- 169
                  .|:.|         .||:..:.....:|:.|.||:...|:.|.          .::|| 
Zfish    94 ------EPKKVCFNYDLFLNLEGNPPVNHLRCEKLTFNNPTHEFRRKLVKAGGVFFSSQAIVVPE 152

  Fly   170 SANGAPGDRTSPQFAMESAMP 190
            .|...|  |.||.:.|...:|
Zfish   153 GAEMMP--RPSPDYPMLPTIP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 16/59 (27%)
mllt1bXP_005171269.1 YEATS 29..109 CDD:281374 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.