DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Mllt1

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_071723.1 Gene:Mllt1 / 64144 MGIID:1927238 Length:547 Species:Mus musculus


Alignment Length:281 Identity:55/281 - (19%)
Similarity:92/281 - (32%) Gaps:97/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RCVISRDIVIGCRMEQCDPDMPYMLEPT-------WGVYLRPGRDGGDLSRFVRRVTFKMSPRLP 89
            :|.:...:.:|.|.:       ...:||       |.|::| |.:..|:..||.:|.|::....|
Mouse     4 QCTVQVKLELGHRAQ-------LRKKPTTEGFTHDWMVFVR-GPEQCDIQHFVEKVIFRLHDSFP 60

  Fly    90 LRLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVV---------REGHAGICEE 145
            ....|....|:::.|...:.|.:.::|.:.:..        .||.|         .||:..:...
Mouse    61 KPKRVCKEPPYKVEESGYAGFIMLIEVYFKNKE--------EPRKVCFTYDLFLNLEGNPPVNHL 117

  Fly   146 MLDKMIFVNPSPMMRQNLT---PVLVPSANGAPGDRTSPQFAMESAMP----------------- 190
            ..:|:.|.||:...|..|.   .|:|.........|.||.:.|...:|                 
Mouse   118 RCEKLTFNNPTTEFRCKLLMAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKNKPSHGSK 182

  Fly   191 --------------------ETPGE-------RKEQDRDREQVGDVAR--PSQPPA-------KQ 219
                                |.|.:       .||.:|:.:...|.||  |.:..|       |:
Mouse   183 DANKESGKASKPHKVAREHRERPRKDSESRSCSKEPEREPKSAKDAARKLPKEEKAPVPKAAFKE 247

  Fly   220 PKKRLS---------VGIPHP 231
            ||..|.         .|:|.|
Mouse   248 PKMALKETKLESLSPKGVPQP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 20/94 (21%)
Mllt1NP_071723.1 YEATS 29..109 CDD:308783 18/88 (20%)
AF-4 <152..>335 CDD:310000 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.