DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and YEATS2

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001338299.1 Gene:YEATS2 / 55689 HGNCID:25489 Length:1423 Species:Homo sapiens


Alignment Length:210 Identity:47/210 - (22%)
Similarity:82/210 - (39%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGRCVISRDIVIGCRMEQCDPDMPYMLEPT---WGVYLRPGRDGGDLSRFVRRVTFKMSPRL-PL 90
            |.|..:.:.||:|...:...||.....:.:   |.||:|..|....::.||::|.|.:.|.. |.
Human   201 TSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPN 265

  Fly    91 RLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGI----CEEMLD--- 148
            .|......||.:......:|||.|||.:.|::......|...::.|. :.|:    .|.::|   
Human   266 DLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRT-YTGLQTLGAETVVDVEL 329

  Fly   149 ------------------------KMIFVNPSPM-----MRQNLTPVLVPSAN--GAP----GDR 178
                                    .:....|:|:     ::|:..||...|..  |.|    .:|
Human   330 HRHSLGEDCIYPQSSESDISDAPPSLPLTIPAPVKASSPIKQSHEPVPDTSVEKAGFPASTEAER 394

  Fly   179 TSPQFAMESAMPETP 193
            .:|.:|:.|::..||
Human   395 HTPFYALPSSLERTP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 27/93 (29%)
YEATS2NP_001338299.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..198
YEATS 231..310 CDD:308783 22/78 (28%)
Histone H3K27cr binding. /evidence=ECO:0000269|PubMed:27103431, ECO:0007744|PDB:5IQL 259..261 0/1 (0%)
Histone H3K27cr binding. /evidence=ECO:0000269|PubMed:27103431, ECO:0007744|PDB:5IQL 282..284 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..541
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 795..843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.