DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Yeats2

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001102527.1 Gene:Yeats2 / 498112 RGDID:1566176 Length:1405 Species:Rattus norvegicus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:78/207 - (37%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGRCVISRDIVIGCRMEQCDPDMPYMLEPT---WGVYLRPGRDGGDLSRFVRRVTFKMSPRL-PL 90
            |.|..:.:.||:|...:...||.....:.:   |.||:|..|....::.||::|.|.:.|.. |.
  Rat   202 TSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPN 266

  Fly    91 RLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGI----CEEMLDKMI 151
            .|......||.:......:|||.|||.:.|::......|...::.|. :.|:    .|.::|..:
  Rat   267 DLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRT-YTGLQTLGAETVVDVEL 330

  Fly   152 --------FVNP-----------------------SPMMRQNLTPVLVPSANGAP----GDRTSP 181
                    :|.|                       ||:.|........|...|.|    .:|.|.
  Rat   331 HRHSLGEDYVYPQSSESDISDAPPPSLTIPAPVKASPVARSPEPASAAPVGEGFPDSTEAERHST 395

  Fly   182 QFAMESAMPETP 193
            .:::.|::..||
  Rat   396 LYSLPSSLERTP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 27/93 (29%)
Yeats2NP_001102527.1 YEATS_YEATS2_like 209..332 CDD:341126 31/123 (25%)
PHA03247 <342..653 CDD:223021 12/66 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.