DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and ear

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster


Alignment Length:275 Identity:52/275 - (18%)
Similarity:73/275 - (26%) Gaps:126/275 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYMLEPTWGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGE------------- 104
            |......|.:|:: |.:..|:|.||.:|.|.:....|....|....|:.|.|             
  Fly    23 PQAFTHDWEIYVQ-GVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQESGYAGFLLPVEIY 86

  Fly   105 ----------------VLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGICEEMLDKMIFV 153
                            ||.|..|.:..|:.......|.|..||.:::|.|  |:           
  Fly    87 FRNRDEPKRIVYQYDLVLQSTGPPQHHVEVKTHIFEAPSEEFRTKLMRGG--GV----------- 138

  Fly   154 NPSPMMRQN-----LTPVLVPS----------------ANGAPG--------------------- 176
               |:...|     |...|.||                |.|.||                     
  Fly   139 ---PVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKSRSEDP 200

  Fly   177 --------------DRTS------PQFAMESAMPETPG-------------ERKEQDRDREQVGD 208
                          .:||      .|..:....||...             |:..:|||:...||
  Fly   201 GKSNAFSALFGPPITKTSVTANNMAQVPVSKHSPEAKSAAVGGKGVFHEGREKASKDRDKSSGGD 265

  Fly   209 VARPSQPPAKQPKKR 223
                 :|..|..|.|
  Fly   266 -----KPREKDKKDR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 20/95 (21%)
earNP_001262595.1 YEATS 27..107 CDD:281374 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.