DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and ear

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster


Alignment Length:275 Identity:52/275 - (18%)
Similarity:73/275 - (26%) Gaps:126/275 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYMLEPTWGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGE------------- 104
            |......|.:|:: |.:..|:|.||.:|.|.:....|....|....|:.|.|             
  Fly    23 PQAFTHDWEIYVQ-GVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQESGYAGFLLPVEIY 86

  Fly   105 ----------------VLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGICEEMLDKMIFV 153
                            ||.|..|.:..|:.......|.|..||.:::|.|  |:           
  Fly    87 FRNRDEPKRIVYQYDLVLQSTGPPQHHVEVKTHIFEAPSEEFRTKLMRGG--GV----------- 138

  Fly   154 NPSPMMRQN-----LTPVLVPS----------------ANGAPG--------------------- 176
               |:...|     |...|.||                |.|.||                     
  Fly   139 ---PVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKHKSRSEDP 200

  Fly   177 --------------DRTS------PQFAMESAMPETPG-------------ERKEQDRDREQVGD 208
                          .:||      .|..:....||...             |:..:|||:...||
  Fly   201 GKSNAFSALFGPPITKTSVTANNMAQVPVSKHSPEAKSAAVGGKGVFHEGREKASKDRDKSSGGD 265

  Fly   209 VARPSQPPAKQPKKR 223
                 :|..|..|.|
  Fly   266 -----KPREKDKKDR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 27/128 (21%)
earNP_001262595.1 YEATS_AF-9_like 5..134 CDD:341125 24/111 (22%)
AHD 867..927 CDD:436050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.