DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Gas41

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster


Alignment Length:130 Identity:36/130 - (27%)
Similarity:63/130 - (48%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKM--SPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMD-A 121
            |.|||:| ....|:|.:|::|.||:  |...|.|:.|  ..|:||.|....:|.|.:::.:.| :
  Fly    43 WKVYLKP-YFNEDMSIYVKKVHFKLHESYANPNRIVV--KPPYEITETGWGEFEVIIKIYFNDQS 104

  Fly   122 RMSATSY----IFRPRVV---------REGHAGICEEMLDKMIFVNPSPMMRQNLTPVLVPSANG 173
            ....|.|    :|:..||         .:...|:..|..::::|..|:.:::..|. :...||||
  Fly   105 ERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLL-LSEQSANG 168

  Fly   174  173
              Fly   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 21/61 (34%)
Gas41NP_609086.1 YEATS 40..119 CDD:281374 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.