DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Gas41

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster


Alignment Length:130 Identity:36/130 - (27%)
Similarity:63/130 - (48%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKM--SPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMD-A 121
            |.|||:| ....|:|.:|::|.||:  |...|.|:.|  ..|:||.|....:|.|.:::.:.| :
  Fly    43 WKVYLKP-YFNEDMSIYVKKVHFKLHESYANPNRIVV--KPPYEITETGWGEFEVIIKIYFNDQS 104

  Fly   122 RMSATSY----IFRPRVV---------REGHAGICEEMLDKMIFVNPSPMMRQNLTPVLVPSANG 173
            ....|.|    :|:..||         .:...|:..|..::::|..|:.:::..|. :...||||
  Fly   105 ERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLL-LSEQSANG 168

  Fly   174  173
              Fly   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 29/108 (27%)
Gas41NP_609086.1 YEATS_GAS41_like 15..159 CDD:341128 31/118 (26%)

Return to query results.
Submit another query.