DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and tfg3

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_593114.1 Gene:tfg3 / 2541729 PomBaseID:SPAC22H12.02 Length:241 Species:Schizosaccharomyces pombe


Alignment Length:59 Identity:20/59 - (33%)
Similarity:28/59 - (47%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMD 120
            |.|.|..:..|.| ||.|||:|:.|............||:|.|....:|.:|:.:.|.|
pombe    40 VCLNPQGEETDAS-FVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYAD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 20/59 (34%)
tfg3NP_593114.1 TFG3 1..238 CDD:227366 20/59 (34%)

Return to query results.
Submit another query.