DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Yeats2

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001139402.1 Gene:Yeats2 / 208146 MGIID:2447762 Length:1407 Species:Mus musculus


Alignment Length:206 Identity:43/206 - (20%)
Similarity:74/206 - (35%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGRCVISRDIVIGCRMEQCDPDMPYMLEPT---WGVYLRPGRDGGDLSRFVRRVTFKMSPRL-PL 90
            |.|..:.:.||:|...:...||.....:.:   |.||:|..|....::.||::|.|.:.|.. |.
Mouse   202 TSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPN 266

  Fly    91 RLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVRE------------------ 137
            .|......||.:......:|||.|||.:.|::......|...::.|.                  
Mouse   267 DLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELH 331

  Fly   138 ----GHAGICEEMLDKMIFVNPSPMM-----------RQNLTP-VLVPSANGAP----GDRTSPQ 182
                |...:..:..:..:...|.|.:           .|:..| ...|...|.|    .:|.|..
Mouse   332 RHSLGEDSVYPQSSESDVCDAPPPTLTLPAAVKASAVAQSPEPAAAAPVGEGFPETTEAERHSTF 396

  Fly   183 FAMESAMPETP 193
            :::.|::..||
Mouse   397 YSLPSSLERTP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 27/93 (29%)
Yeats2NP_001139402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..196
YEATS_YEATS2_like 209..332 CDD:341126 28/122 (23%)
Histone H3K27cr binding. /evidence=ECO:0000250|UniProtKB:Q9ULM3 260..262 0/1 (0%)
Histone H3K27cr binding. /evidence=ECO:0000250|UniProtKB:Q9ULM3 283..285 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..833
PRK07003 <887..>1123 CDD:235906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.