DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Yeats2

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001139402.1 Gene:Yeats2 / 208146 MGIID:2447762 Length:1407 Species:Mus musculus


Alignment Length:206 Identity:43/206 - (20%)
Similarity:74/206 - (35%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGRCVISRDIVIGCRMEQCDPDMPYMLEPT---WGVYLRPGRDGGDLSRFVRRVTFKMSPRL-PL 90
            |.|..:.:.||:|...:...||.....:.:   |.||:|..|....::.||::|.|.:.|.. |.
Mouse   202 TSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPN 266

  Fly    91 RLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVRE------------------ 137
            .|......||.:......:|||.|||.:.|::......|...::.|.                  
Mouse   267 DLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELH 331

  Fly   138 ----GHAGICEEMLDKMIFVNPSPMM-----------RQNLTP-VLVPSANGAP----GDRTSPQ 182
                |...:..:..:..:...|.|.:           .|:..| ...|...|.|    .:|.|..
Mouse   332 RHSLGEDSVYPQSSESDVCDAPPPTLTLPAAVKASAVAQSPEPAAAAPVGEGFPETTEAERHSTF 396

  Fly   183 FAMESAMPETP 193
            :::.|::..||
Mouse   397 YSLPSSLERTP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 29/141 (21%)
Yeats2NP_001139402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..196
YEATS_YEATS2_like 209..332 CDD:341126 28/122 (23%)
Histone H3K27cr binding. /evidence=ECO:0000250|UniProtKB:Q9ULM3 260..262 0/1 (0%)
Histone H3K27cr binding. /evidence=ECO:0000250|UniProtKB:Q9ULM3 283..285 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..833
PRK07003 <887..>1123 CDD:235906
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.