powered by:
Protein Alignment CG2652 and Y105E8B.7
DIOPT Version :9
Sequence 1: | NP_570015.1 |
Gene: | CG2652 / 31250 |
FlyBaseID: | FBgn0025838 |
Length: | 235 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493542.2 |
Gene: | Y105E8B.7 / 190914 |
WormBaseID: | WBGene00013692 |
Length: | 269 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 13/60 - (21%) |
Similarity: | 29/60 - (48%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 WGVYLRPG-RDGGDL--SRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQV 116
|.::::|| ||..:. ::.:::|.|::.......:......||:|.|...:.|...|.:
Worm 27 WTLFVKPGNRDYDEFPDNKLIQKVKFEIHESFAQPVRFVTKPPFKITETGFASFTTLVTI 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2652 | NP_570015.1 |
YEATS |
26..>120 |
CDD:303059 |
13/60 (22%) |
Y105E8B.7 | NP_493542.2 |
YEATS |
24..105 |
CDD:281374 |
13/60 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5033 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S932 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.760 |
|
Return to query results.
Submit another query.