DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Y105E8B.7

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_493542.2 Gene:Y105E8B.7 / 190914 WormBaseID:WBGene00013692 Length:269 Species:Caenorhabditis elegans


Alignment Length:60 Identity:13/60 - (21%)
Similarity:29/60 - (48%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPG-RDGGDL--SRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQV 116
            |.::::|| ||..:.  ::.:::|.|::.......:......||:|.|...:.|...|.:
 Worm    27 WTLFVKPGNRDYDEFPDNKLIQKVKFEIHESFAQPVRFVTKPPFKITETGFASFTTLVTI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 13/60 (22%)
Y105E8B.7NP_493542.2 YEATS 24..105 CDD:281374 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.