DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Y105E8B.7

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_493542.2 Gene:Y105E8B.7 / 190914 WormBaseID:WBGene00013692 Length:269 Species:Caenorhabditis elegans


Alignment Length:60 Identity:13/60 - (21%)
Similarity:29/60 - (48%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPG-RDGGDL--SRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQV 116
            |.::::|| ||..:.  ::.:::|.|::.......:......||:|.|...:.|...|.:
 Worm    27 WTLFVKPGNRDYDEFPDNKLIQKVKFEIHESFAQPVRFVTKPPFKITETGFASFTTLVTI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 13/60 (22%)
Y105E8B.7NP_493542.2 YEATS_AF-9_like 4..133 CDD:341125 13/60 (22%)

Return to query results.
Submit another query.