DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and yeats2

DIOPT Version :9

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002660941.3 Gene:yeats2 / 100320774 ZFINID:ZDB-GENE-081104-292 Length:1421 Species:Danio rerio


Alignment Length:241 Identity:51/241 - (21%)
Similarity:89/241 - (36%) Gaps:49/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DDCQRVSCNRTPPITVTGRCVISRDIVIGCRMEQCDPDMPYMLEPT---WGVYLRPGRDGGDLSR 75
            ||..|:...:|              ||:|...:...||.....:.:   |.||:|..|....:..
Zfish   196 DDASRLYMKKT--------------IVVGNVSKYIAPDKREENDQSTHKWMVYVRGSRKEPSIDH 246

  Fly    76 FVRRVTFKMSPRL-PLRLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGH 139
            ||::|.|.:.|.. |..|......||.:......:|||.||:.:.|.|......|...::.|. :
Zfish   247 FVKKVWFFLHPSYKPNDLVEVSEPPFHLTRRGWGEFPVRVQIHFKDQRNKRIDIIHHLKLDRT-Y 310

  Fly   140 AGI----CEEMLDKMIFVNPSPMMRQNLTPVLVPSANGAPGDRTS-PQF-------------AME 186
            .|:    .|.::|..::       |.:|....:|||..:....:| |.|             :..
Zfish   311 TGLQTLGAETVVDVQLY-------RNSLGDDFIPSAPSSSSSSSSYPAFVGGSGSSSSTIHGSRR 368

  Fly   187 SAMPETPGERKEQDRDREQV--GDVARPS---QPPAKQPKKRLSVG 227
            ::.|..|....:...:|...  .:..|||   |.......:::::|
Zfish   369 NSSPSRPAHDDQHSSERGVTVKSESVRPSCLEQTSQSNRSEKITLG 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 24/97 (25%)
yeats2XP_002660941.3 SCAB_CC <16..>75 CDD:293317
YEATS 228..307 CDD:281374 22/78 (28%)
PHA03255 938..>1109 CDD:165513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.