DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and msgn1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:161 Identity:39/161 - (24%)
Similarity:65/161 - (40%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DFSL-NDTEEDEEDLRDYIVLNGNQADANRSLSSSPRSHSRNGLLTAPASSGSSVGG-------- 138
            |::| :|:|.:...:........|....:.|.:.||:|.|......:|.||.|...|        
 Frog    14 DYALSSDSEPNSSCMASTWDWKNNDERYSLSQTPSPQSLSPAVSYESPYSSSSHTQGLEEMPFSY 78

  Fly   139 ------SGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELR-KLVPTHP 196
                  |...|.||.......|....:...   |:...:.||:.|.:.::.|...|| .|.|.:.
 Frog    79 SLLQYPSLCHGDNGDLTKKDHGHKPSMTVQ---RRRKASEREKLRMRAIAEALHTLRNNLPPMYS 140

  Fly   197 PDKK-LSKNEILRSAIKYIKLLTGILEWQQR 226
            ..:: |:|.:.|:..|.||..||.:|:..:|
 Frog   141 QGRQPLTKIQTLKCTINYISELTNLLQCSKR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 16/52 (31%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 14/54 (26%)
bHLH_TS_Msgn1 102..167 CDD:381509 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.