DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Tcf23

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006504158.1 Gene:Tcf23 / 69852 MGIID:1934960 Length:216 Species:Mus musculus


Alignment Length:183 Identity:46/183 - (25%)
Similarity:61/183 - (33%) Gaps:71/183 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NQADANRSLSSSPRSHSR---------------NGLLTAPASS--GSSVGGSGGGGGNGSGGNAS 152
            |:|.| |.|..:.|..||               |..|:...|:  |:...|:..|....|..||:
Mouse    19 NKAKA-RWLLGTDRKRSRINRTRQDLWEDTSWSNHRLSRATSAPRGTRARGTAHGRSEASPENAA 82

  Fly   153 SGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLL 217
                                |||.|.:.:..||..|:..:|..|||.||||.::|..|..||..|
Mouse    83 --------------------RERTRVKTLRQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHL 127

  Fly   218 TGILEWQQRQAPSHPIRAQMEPNNNDNRMANGHAADGENLENPDVPP-VRHIK 269
            |..|                                |..|..|..|| ||.::
Mouse   128 TRTL--------------------------------GHELPGPAWPPFVRGLR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 21/50 (42%)
Tcf23XP_006504158.1 bHLH_TS_TCF23_OUT 77..132 CDD:381552 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.