DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and TAL1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens


Alignment Length:324 Identity:92/324 - (28%)
Similarity:119/324 - (36%) Gaps:122/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NGADNADERSTASS------GSSGHSQTNESPRSGHLNGNGSMRD-------TAAGRH---PPAL 57
            ||......|:.|:.      |:.|      .|..|...|.|:.||       ||..||   ...|
Human    35 NGVAKETSRAAAAEPPVIELGARG------GPGGGPAGGGGAARDLKGRDAATAEARHRVPTTEL 93

  Fly    58 LRHATPHLQPKTESIS---DGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPRS 119
            .|...|...|...|::   .|||                                 |.:..||.:
Human    94 CRPPGPAPAPAPASVTAELPGDG---------------------------------RMVQLSPPA 125

  Fly   120 HSRNGLLTAPASSG-------SSVGGSGGGGGNGSGG--------------------NASSGGGS 157
                  |.|||:.|       |....|.|.|..|...                    ..:.|..:
Human   126 ------LAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHT 184

  Fly   158 GVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            .|     ||::|||:|||||||||:|||||||||:||||||||||||||||.|:|||..|..:|.
Human   185 KV-----VRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLN 244

  Fly   223 WQQRQA--------------------------PSHPIRAQMEPNNNDNRMANGHAADGENLENP 260
            .|:.:.                          |...::..:.||::.....:|.|:.....|.|
Human   245 DQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 40/50 (80%)
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86 12/51 (24%)
HLH 193..243 CDD:197674 40/49 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331 7/60 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7474
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007786
OrthoInspector 1 1.000 - - otm41680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5855
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.