DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Scx

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001123980.1 Gene:Scx / 680712 RGDID:1588254 Length:209 Species:Rattus norvegicus


Alignment Length:279 Identity:72/279 - (25%)
Similarity:91/279 - (32%) Gaps:116/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ALLRHATP---HLQPKTESIS-DGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSS 116
            |:||.|.|   :|.|:...:| |.|..:|.|.       .||:..|.:....|.|          
  Rat     4 AMLRSAPPPGRYLYPEVSPLSEDEDRGSESSG-------SDEKPCRVHAARCGLQ---------- 51

  Fly   117 PRSHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGG--VRKVFT-NTRERWRQ 178
                                     |....:||..::|.|.|.|...|  .|:..| |.|||.|.
  Rat    52 -------------------------GARRRAGGRRAAGSGPGPGGRPGREPRQRHTANARERDRT 91

  Fly   179 QNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEPNNND 243
            .:|:.||..||.|:||.|.|:||||.|.||.|..||..|..:|                      
  Rat    92 NSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVL---------------------- 134

  Fly   244 NRMANGHAADGENLENPDVPPVRHIKCERTDGQMHRNGIGHGHANGNAGNDLLMIAPGAVVKSEL 308
               ..|.|..                    |||...:|....| :|.||:               
  Rat   135 ---LVGEACG--------------------DGQPCHSGPAFFH-SGRAGS--------------- 160

  Fly   309 LLESTLPLGHPLNGPPLPL 327
                  ||..|...|||||
  Rat   161 ------PLPPPPPPPPLPL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 26/50 (52%)
ScxNP_001123980.1 bHLH_TS_scleraxis 76..143 CDD:381521 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.