DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Ascl4

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus


Alignment Length:107 Identity:33/107 - (30%)
Similarity:49/107 - (45%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            ||.....:|:  .|.|||.|.:.|:..:|.||:.:|.....::|||.|.||:||.|||.|..:||
Mouse    54 GVAEPAFLRQ--RNERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAISYIKQLQELLE 116

  Fly   223 WQQRQAPSHPIRAQMEPNNNDNRMANGHAADGENLENPDVPP 264
                         :..|:.|         :|||:..:....|
Mouse   117 -------------RHRPDCN---------SDGESKASSGASP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 22/50 (44%)
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.