DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and SCX

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens


Alignment Length:227 Identity:66/227 - (29%)
Similarity:86/227 - (37%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ALLRHATP--HLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPR 118
            |.||.|.|  :|.|:...:|                 |||:          ..:|::.|.....|
Human     4 ATLRPAPPGRYLYPEVSPLS-----------------EDED----------RGSDSSGSDEKPCR 41

  Fly   119 SH-SRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGV--RKVFTNTRERWRQQN 180
            .| :|.||               .|....:||..:.|||.| |..|..  ::...|.|||.|..:
Human    42 VHAARCGL---------------QGARRRAGGRRAGGGGPG-GRPGREPRQRHTANARERDRTNS 90

  Fly   181 VSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEPNNNDNR 245
            |:.||..||.|:||.|.|:||||.|.||.|..||..|..:|...:......|..         :.
Human    91 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDGQPCH---------SG 146

  Fly   246 MANGHAA-DGENLENPDVPPVRHIKCERTDGQ 276
            .|..||| .|.....|..||.|       ||:
Human   147 PAFFHAARAGSPPPPPPPPPAR-------DGE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 26/50 (52%)
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 32/130 (25%)
bHLH_TS_scleraxis 73..140 CDD:381521 27/66 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.