DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Ascl1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:145 Identity:45/145 - (31%)
Similarity:62/145 - (42%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 APASSGSSVGGSGGGGGNGSGGNAS------------------SGGGSGVGATGGVRKVFTNTRE 174
            ||..|..:.|...|||...:.....                  ||.|..:...........|.||
  Rat    60 APQLSPVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERE 124

  Fly   175 RWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRA---- 235
            |.|.:.|:..||.||:.||....:||:||.|.||||::||:.|..:|:  :..|.|...:|    
  Rat   125 RNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLD--EHDAVSAAFQAGVLS 187

  Fly   236 -QMEPN-NND-NRMA 247
             .:.|| :|| |.||
  Rat   188 PTISPNYSNDLNSMA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95 7/34 (21%)
HLH 131..173 CDD:197674 20/43 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.