DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Hand1

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_067603.1 Gene:Hand1 / 59112 RGDID:621206 Length:216 Species:Rattus norvegicus


Alignment Length:159 Identity:42/159 - (26%)
Similarity:68/159 - (42%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RSHSRNGLLT-APASSGSSVGG-------SGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRE 174
            |.:.::.||: |.|:.....||       :....|..:..:.|.|....:|.....||.....:|
  Rat    39 RPYFQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQSPGRLEALGGRLPRRKGSGPKKE 103

  Fly   175 RWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEP 239
            |.|.::::.||||||:.:|..|.|.||||.:.||.|..||..|..:|....:.......:|::  
  Rat   104 RRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAEL-- 166

  Fly   240 NNNDNRMANGHAADGENLENPD----VPP 264
                 :..:|........|:|.    :||
  Rat   167 -----KKTDGGRESKRKRESPQQHEGLPP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 25/58 (43%)
Hand1NP_067603.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..109 9/35 (26%)
bHLH_TS_HAND1 94..153 CDD:381522 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.