DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and atoh7

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571707.1 Gene:atoh7 / 58216 ZFINID:ZDB-GENE-000926-1 Length:134 Species:Danio rerio


Alignment Length:56 Identity:28/56 - (50%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGIL 221
            |::..|.|||.|.|.::.||..|||:||....||||||.|.|:.|:.||..|..||
Zfish    29 RRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLSKYETLQMALSYIMALNRIL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 28/56 (50%)
atoh7NP_571707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
bHLH_TS_ATOH7 22..90 CDD:381557 28/56 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.