DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and hand2

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:136 Identity:41/136 - (30%)
Similarity:60/136 - (44%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 APASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLV 192
            ||....|..||..|.|..|.|.....            |:...|.:||.|.|:::.||||||:.:
Zfish    62 APGLDHSHYGGVPGAGAVGMGPRTVK------------RRPTANRKERRRTQSINSAFAELRECI 114

  Fly   193 PTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEPNN----------NDNRMA 247
            |..|.|.||||.:.||.|..||..|..||:..::...:...:|:.:..:          ||...:
Zfish   115 PNVPADTKLSKIKTLRLATSYIAYLMDILDKDEQNGETEAFKAEFKKTDAKEERRKKEMNDVLKS 179

  Fly   248 NGHAAD 253
            :|.:.|
Zfish   180 SGSSND 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 25/50 (50%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 9/38 (24%)
HLH 88..139 CDD:278439 24/50 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.