powered by:
Protein Alignment HLH3B and mespba
DIOPT Version :9
Sequence 1: | NP_525055.1 |
Gene: | HLH3B / 31249 |
FlyBaseID: | FBgn0011276 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571627.1 |
Gene: | mespba / 58070 |
ZFINID: | ZDB-GENE-000406-9 |
Length: | 236 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 18/58 - (31%) |
Similarity: | 31/58 - (53%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 RKVFTNTRERWRQQNVSGAFAELRKLVPTH--PPDKKLSKNEILRSAIKYIKLLTGIL 221
|:...:.:|:.|.::::.|...||..:|.. |..:.|:|.|.||..|:||..|:..|
Zfish 67 RRQNASEKEKLRMRDLTKALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFLSSQL 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH3B | NP_525055.1 |
HLH |
171..222 |
CDD:197674 |
17/53 (32%) |
mespba | NP_571627.1 |
HLH |
67..120 |
CDD:278439 |
16/52 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.