DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and mespba

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:58 Identity:18/58 - (31%)
Similarity:31/58 - (53%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RKVFTNTRERWRQQNVSGAFAELRKLVPTH--PPDKKLSKNEILRSAIKYIKLLTGIL 221
            |:...:.:|:.|.::::.|...||..:|..  |..:.|:|.|.||..|:||..|:..|
Zfish    67 RRQNASEKEKLRMRDLTKALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFLSSQL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 18/58 (31%)
mespbaNP_571627.1 bHLH_SF 67..131 CDD:469605 18/58 (31%)

Return to query results.
Submit another query.