DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and tcf21

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001032770.1 Gene:tcf21 / 558148 ZFINID:ZDB-GENE-051113-88 Length:176 Species:Danio rerio


Alignment Length:177 Identity:53/177 - (29%)
Similarity:75/177 - (42%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LSDFSLNDTEE-DEEDLRDYIVLNGNQADANRSLSSSPRSHSRNGLLTAPASSGSSVGGSGGGGG 144
            :|..|::|.:| .|.:|.|.:...|:..|...|..|:..|.:         ..|:||  |...|.
Zfish     1 MSTGSISDVDEFHESELLDGLPKFGSGKDPGTSNESTEDSSN---------CEGASV--SECTGK 54

  Fly   145 NGSGGNASSGGGSGVGATG-GVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILR 208
            .....|......:||...| .|::...|.|||.|.:.:|.||:.|:..:|..|||.||||.:.||
Zfish    55 RRKSANMRRSAPNGVAQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLR 119

  Fly   209 SAIKYIKLLTGIL-EWQQRQAPSHPIRAQM------EPNNNDNRMAN 248
            .|..||..|..|| ..:......||:....      :|.|....|.|
Zfish   120 LASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPENELKEMLN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 25/51 (49%)
tcf21NP_001032770.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84 23/93 (25%)
HLH 77..129 CDD:278439 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.