DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and figla

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001016342.1 Gene:figla / 549096 XenbaseID:XB-GENE-966403 Length:203 Species:Xenopus tropicalis


Alignment Length:57 Identity:24/57 - (42%)
Similarity:39/57 - (68%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            |:...|.:||.|.:|::..|::|:.:||..|.|:|.||.:.|::|.:||:||..|||
 Frog    59 RRQAANAKERERIRNINSGFSKLKTIVPLIPKDRKPSKVDTLKAATEYIRLLHDILE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 21/50 (42%)
figlaNP_001016342.1 HLH 58..115 CDD:238036 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.