DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and ASCL2

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:114 Identity:38/114 - (33%)
Similarity:49/114 - (42%) Gaps:22/114 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 ASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIK 215
            |.:|||:...|.       .|.|||.|.:.|:..|..||:.||.....|||||.|.||||::||:
Human    43 AETGGGAAAVAR-------RNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIR 100

  Fly   216 LLTGILEWQQRQAPSHPIRAQMEPNNNDNRMANGHAADGENLENPDVPP 264
            .|..:|      |....:|         |.:|.|..........|..||
Human   101 ALQRLL------AEHDAVR---------NALAGGLRPQAVRPSAPRGPP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 25/58 (43%)
ASCL2NP_005161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..56 5/19 (26%)
bHLH_TS_ASCL2_Mash2 49..112 CDD:381586 27/75 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..177 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.