powered by:
Protein Alignment HLH3B and nhlh2
DIOPT Version :9
Sequence 1: | NP_525055.1 |
Gene: | HLH3B / 31249 |
FlyBaseID: | FBgn0011276 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991232.1 |
Gene: | nhlh2 / 402968 |
ZFINID: | ZDB-GENE-040426-1809 |
Length: | 122 |
Species: | Danio rerio |
Alignment Length: | 51 |
Identity: | 33/51 - (64%) |
Similarity: | 38/51 - (74%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 TRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
||||.|.:..:.||||||||:||.||||||||.||||.||.||..|..:|:
Zfish 71 TRERIRVEAFNVAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLD 121
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH3B | NP_525055.1 |
HLH |
171..222 |
CDD:197674 |
32/49 (65%) |
nhlh2 | NP_991232.1 |
HLH |
66..116 |
CDD:278439 |
31/44 (70%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.