powered by:
Protein Alignment HLH3B and tal2
DIOPT Version :9
Sequence 1: | NP_525055.1 |
Gene: | HLH3B / 31249 |
FlyBaseID: | FBgn0011276 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_958496.3 |
Gene: | tal2 / 394239 |
ZFINID: | ZDB-GENE-040115-1 |
Length: | 109 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 46/66 - (69%) |
Similarity: | 54/66 - (81%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 RKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPS 230
|||||||||||||.||:.||||||||:|||||:||||||||||.|::||..|..:||.|..:..:
Zfish 3 RKVFTNTRERWRQHNVNTAFAELRKLIPTHPPEKKLSKNEILRLAMRYINFLVTLLESQGGEPSA 67
Fly 231 H 231
|
Zfish 68 H 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH3B | NP_525055.1 |
HLH |
171..222 |
CDD:197674 |
37/50 (74%) |
tal2 | NP_958496.3 |
HLH |
8..60 |
CDD:197674 |
38/51 (75%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
94 |
1.000 |
Domainoid score |
I7410 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm26295 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5855 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.800 |
|
Return to query results.
Submit another query.