DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and HLH54F

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:93/229 - (40%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIK-LLTGILEWQQRQA 228
            |::...|.|||.|.:.:|.|:..|:..:|..|||.||||.:.||.|..||| |:|.:      :.
  Fly    31 VQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAV------ET 89

  Fly   229 PSHPIRAQMEPNNNDNRMANGHA----ADGENLENPDVPPVRHIKCERTDGQMHRNGIGHG---- 285
            .||   :|..|:|::...:..|:    ...|.|:      ..|:......|..:.:..|||    
  Fly    90 GSH---SQNHPHNHNQHHSLNHSHSSTTSSEGLD------TSHMADSSGGGNYNFHNNGHGMSWP 145

  Fly   286 ---HANGNAGNDLLMIAPGAVVKSELLLESTLPLGHPLNGPPLPLTTAPLAMAETQRISGTVSGV 347
               |.:..:    |..||.:...|...::     ...|:....|.||    ..|| .:|..:|..
  Fly   146 FEFHQSSRS----LAFAPSSSTTSSARMD-----WQTLHTQSYPKTT----RGET-HVSADLSYH 196

  Fly   348 KSASGRS-----SKRRLKPEGGAT-DLSLGKRRR 375
            :.....|     ...:::|....: |..:|:.:|
  Fly   197 QLPESHSHWYPAEVHQMEPAASCSYDSGMGQHQR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/51 (47%)
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.