DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Ferd3l

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001102450.1 Gene:Ferd3l / 366598 RGDID:1311812 Length:166 Species:Rattus norvegicus


Alignment Length:193 Identity:47/193 - (24%)
Similarity:74/193 - (38%) Gaps:60/193 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AAGRHPPALLRHATPHL--QPKTESISDGDG---------DAELSDFSLNDTEEDEEDLRDYIVL 102
            |:.|||  .|....|.:  :.:|....:|.|         :.|..:....|.||:||:       
  Rat    23 ASPRHP--FLCEFPPGVPFEDQTLGFREGRGLLQFEGRYQEVEGGEVDYEDPEEEEEE------- 78

  Fly   103 NGNQADANRSLSSSPRSHSRNGLLTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRK 167
             |.......||...|:   |..::|.                                    .::
  Rat    79 -GEGRGRVASLLGRPK---RKRVITY------------------------------------AQR 103

  Fly   168 VFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPS 230
            ...|.|||.|..|::.||.:||:.|||...:|:||:.|.||.||.||..:|.:|:.::.:..|
  Rat   104 QAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)
Ferd3lNP_001102450.1 HLH 102..154 CDD:278439 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.