DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Msc

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_008761698.1 Gene:Msc / 312897 RGDID:1305496 Length:220 Species:Rattus norvegicus


Alignment Length:215 Identity:59/215 - (27%)
Similarity:83/215 - (38%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSGSSGHSQTNESPRSGHLNGNGSMRDTAAGRHPPALLRHATPHLQPKTESISDGDGDAELSDFS 85
            |:||.      ..|....:.|...:....|.:.|| |||....:..|...|.::.:         
  Rat     2 STGSV------SDPEDTEMRGLQRVYPAPASKRPP-LLRPERSYASPSDNSSAEEE--------- 50

  Fly    86 LNDTEEDEEDLRDYIVLNGNQADANRSLSSSPRSHSRNGLLTAPASSGSSVGGSGGGGGNGSGGN 150
              |.:.:||.        |....|.......||              |:...|:|||.|: :|..
  Rat    51 --DPDGEEEP--------GTVGAAGGCKRKRPR--------------GADASGAGGGAGS-TGKK 90

  Fly   151 ASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIK 215
            |....||........|.. .|.|||.|.:.:|.||:.|:..:|..|||.||||.:.||.|..||.
  Rat    91 ALPPKGSAAECKQSQRNA-ANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIA 154

  Fly   216 LLTGILEWQQRQAPS--HPI 233
            .|..:|: :.|...|  ||:
  Rat   155 HLRQLLQ-EDRYEDSYVHPV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 23/50 (46%)
MscXP_008761698.1 bHLH_TS_musculin 102..167 CDD:381546 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.