DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and sc

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:135 Identity:38/135 - (28%)
Similarity:63/135 - (46%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 IVLNGNQADANRSLSSSPRSHSRNGL-LTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATG 163
            ::..|||.....::....|.::..|: ||..:.|.||:          |.|  ||.....|..:.
  Fly    47 LIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSL----------SPG--SSPAPYNVDQSQ 99

  Fly   164 GVRKVFTNTRERWRQQNVSGAFAELRKLVPT-----------HPPDKKLSKNEILRSAIKYIKLL 217
            .|::  .|.|||.|.:.|:.:||.||:.:|.           ..|.||:||.:.||.|::||:.|
  Fly   100 SVQR--RNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRL 162

  Fly   218 TGILE 222
            ..:::
  Fly   163 QDLVD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 22/61 (36%)
scNP_476803.1 HLH 105..163 CDD:278439 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.