DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Lyl1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001007678.1 Gene:Lyl1 / 304663 RGDID:1359244 Length:278 Species:Rattus norvegicus


Alignment Length:299 Identity:89/299 - (29%)
Similarity:111/299 - (37%) Gaps:105/299 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ADNADERSTASSG-SSGHSQTNESPRSGHLNGNGSMRDT--------------AAGRHPPALLRH 60
            |:..|.|:|.:.. ..|....|    .||....|:...|              |.|..||.|..|
  Rat    42 AEEVDHRNTCNPWLPPGVPVIN----LGHTRPTGAAMPTTELSAFRPSLLQLAALGTAPPTLALH 102

  Fly    61 ATPHLQPKTESISDGDGDAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSSPRSHSRNGL 125
            ..||  |...|:..|..    ..||:                     ..|..|...| ||....|
  Rat   103 YHPH--PFLNSVYIGPA----GPFSI---------------------FPNSRLKRRP-SHGELDL 139

  Fly   126 LTAPASSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRK 190
            :                              .|.......|:||||:|||||||:|:||||||||
  Rat   140 V------------------------------DGHQPQKVARRVFTNSRERWRQQHVNGAFAELRK 174

  Fly   191 LVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQ------------QRQAPSHPIRAQMEPNNND 243
            |:||||||:||||||:||.|:|||..|..:|..|            .|:.|:|   ..:|.|   
  Rat   175 LLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAVLASGPSAPGSRKPPAH---RGVEGN--- 233

  Fly   244 NRMANGHAADGENLENPDVP---------PVRHIKCERT 273
            .|...||..:... ..|.:|         .||.||.|:|
  Rat   234 ARCGAGHRVEAAR-SQPVLPGDCDGDPNGSVRPIKMEQT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 37/50 (74%)
Lyl1NP_001007678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 4/9 (44%)
HLH 155..207 CDD:197674 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..278 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7280
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45801
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13864
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.