DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and ascl1a

DIOPT Version :10

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:52 Identity:25/52 - (48%)
Similarity:35/52 - (67%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            |.|||.|.:.|:..||.||:.||....:||:||.|.||||::||:.|..:|:
Zfish    84 NERERNRVKLVNNGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 25/52 (48%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54
bHLH_TS_ASCL1_Mash1 75..145 CDD:381585 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.