DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Mesp2

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:353 Identity:79/353 - (22%)
Similarity:109/353 - (30%) Gaps:148/353 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LSSSPRSHSRNGL----------------LTAPASSGSSVGGS---GGGGGNGSGGNASSGGGSG 158
            ::.||:..|..||                .|:||||..|.|..   .....:.|.|.|.|...:.
  Rat     1 MAQSPQPQSLQGLDHWVFSQGWGWARHSDSTSPASSSDSSGSCPCYATRPPSQSTGPARSARNTQ 65

  Fly   159 VG---------ATGGVRKVFTNTRERWRQQNVSGAFAELRKLVP--THPPDKKLSKNEILRSAIK 212
            |.         |..|.::...:.||:.|.:.::.|..|||:.:|  ..|..:.|:|.|.||.||:
  Rat    66 VAPNAPRRARPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTKIETLRLAIR 130

  Fly   213 YI---KLLTGILEWQQR----------------QAP--SHPIRAQM------------------- 237
            ||   ..|.|:.|...|                |.|  |.|.:|||                   
  Rat   131 YIGHLSALLGLSEDSLRRRRRRSADAAFSHRCPQCPDDSSPSQAQMLGPSLGSDISSGLSWGCPP 195

  Fly   238 -------EPNNNDNRMAN---------------------GHAADGENLENPDVPPVRHIKCERTD 274
                   .|.|..:|::|                     ..|||..:...|...|...|..|   
  Rat   196 ACPGPIISPENLGSRISNVDPWVTPPYCSQIQSPLHQSLERAADTSHWAPPHACPGMQISPE--- 257

  Fly   275 GQMHRNGIGHGHANGNAGN-----DLLMIAPGAVVKSELLLESTLPLGHPLNGPPLPLTTAPLAM 334
               .||..||..|:.....     ..|.::|          |..|.||.|   |.||        
  Rat   258 ---PRNKTGHWTASTEPAELTKVYQSLSVSP----------EPCLALGSP---PLLP-------- 298

  Fly   335 AETQRISGTVSGVKSASGRSSKRRLKPE 362
                              |.|.:||:|:
  Rat   299 ------------------RPSCQRLQPQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 20/55 (36%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.