DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH3B and Nhlh1

DIOPT Version :9

Sequence 1:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001099440.1 Gene:Nhlh1 / 289230 RGDID:1310261 Length:133 Species:Rattus norvegicus


Alignment Length:122 Identity:50/122 - (40%)
Similarity:56/122 - (45%) Gaps:31/122 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PASSGSSVGGSGGGGGNGSGGNASSGGGSGVG----------------------------ATGGV 165
            |..|.:..|.|..|||.|..|..|  |..|||                            ||...
  Rat    14 PTHSETESGFSDCGGGPGPDGAGS--GDPGVGQVRSLELGESGRKDLQHLSREERRRRRRATAKY 76

  Fly   166 RKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
            |.... ||||.|.:..:.||||||||:||.||||||||.||||.||.||..|..:|:
  Rat    77 RTAHA-TRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH3BNP_525055.1 HLH 171..222 CDD:197674 32/50 (64%)
Nhlh1NP_001099440.1 bHLH_TS_HEN1 61..132 CDD:381544 35/71 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.